General Information

  • ID:  hor002224
  • Uniprot ID:  P04090
  • Protein name:  Relaxin A chain
  • Gene name:  RLN2
  • Organism:  Homo sapiens (Human)
  • Family:  Insulin family
  • Source:  Human
  • Expression:  Isoform 1 is expressed in the ovary during pregnancy. Also expressed in placenta, decidua and prostate. Isoform 2 is relatively abundant in placenta. It is in much lower abundance in the prostate gland. Not detected in the ovary.
  • Disease:  Diseases associated with RLN2 include Bone Squamous Cell Carcinoma and Spermatogenic Failure 8.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007565 female pregnancy; GO:0010628 positive regulation of gene expression; GO:0045766 positive regulation of angiogenesis; GO:0050790 regulation of catalytic activity
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QLYSALANKCCHVGCTKRSLARFC
  • Length:  24
  • Propeptide:  MPRLFFFHLLGVCLLLNQFSRAVADSWMEEVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETINMMSEFVANLPQELKLTLSEMQPALPQLQQHVPVLKDSSLLFEEFKKLIRNRQSEAADSSPSELKYLGLDTHSRKKRQLYSALANKCCHVGCTKRSLARFC
  • Signal peptide:  MPRLFFFHLLGVCLLLNQFSRAVA
  • Modification:  T1 Pyrrolidone carboxylic acid
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  RXFP1, RXFP2
  • Target Unid:  Q9HBX9, Q8WXD0
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  10-15
  • Structure ID:  AF-P04090-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002224_AF2.pdbhor002224_ESM.pdb

Physical Information

Mass: 308363 Formula: C113H186N36O31S4
Absent amino acids: DEIMPW Common amino acids: C
pI: 9.06 Basic residues: 5
Polar residues: 10 Hydrophobic residues: 8
Hydrophobicity: 11.67 Boman Index: -3402
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 73.33
Instability Index: 7497.08 Extinction Coefficient cystines: 1740
Absorbance 280nm: 75.65

Literature

  • PubMed ID:  2076464
  • Title:  Structural Characterization by Mass Spectrometry of Native and Recombinant Human Relaxin